| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Apc1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Apc1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Apc1. This antibody reacts with human. The Apc1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Apc1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSV |
|---|
| Other Names | anaphase promoting complex subunit 1, anaphase-promoting complex 1 (meiotic checkpoint regulator), anaphase-promoting complex subunit 1, APC1Testis-specific gene 24 protein, Cyclosome subunit 1, Mitotic checkpoint regulator, TSG24MCPR |
|---|
| Gene, Accession # | ANAPC1, Gene ID: 64682, Accession: Q9H1A4, SwissProt: Q9H1A4 |
|---|
| Catalog # | NBP2-37901 |
|---|
| Price | |
|---|
| Order / More Info | Apc1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|