| Edit |   |
|---|
| Antigenic Specificity | Apc10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Apc10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Apc10. This antibody reacts with human. The Apc10 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: 10 |
|---|
| Immunogen | Synthetic peptides corresponding to ANAPC10(anaphase promoting complex subunit 10) The peptide sequence was selected from the N terminal of ANAPC10. Peptide sequence MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL. |
|---|
| Other Names | anaphase promoting complex subunit 10, anaphase-promoting complex subunit 10, APC10DOC1, Cyclosome subunit 10, DKFZP564L0562 |
|---|
| Gene, Accession # | ANAPC10, Gene ID: 10393, Accession: Q9UM13, SwissProt: Q9UM13 |
|---|
| Catalog # | NBP1-58197 |
|---|
| Price | |
|---|
| Order / More Info | Apc10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|