| 产品详情 |
| Edit |   |
| Antigenic Specificity | GSDMDC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.025 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GSDMDC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GSDMDC1. This antibody reacts with human, mouse. The GSDMDC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Other Names | DF5L, DFNA5L, FLJ12150, gasdermin D, gasdermin domain containing 1, Gasdermin domain-containing protein 1, gasdermin-D, GSDMDC1 |
| Gene, Accession # | GSDMD, Gene ID: 79792, Accession: P57764, SwissProt: P57764 |
| Catalog # | NBP2-33422-0.025ml |
| Price | |
| Order / More Info | GSDMDC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26375003, 27383986, 27820798, 28392147, 29195211, 29195811, 29967349, 30156437, 30250284, 30473634, 30669285 |
| 产品资料 |
|
|