| Edit |   |
|---|
| Antigenic Specificity | GSH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unpurified, no preservative |
|---|
| Size | 0.05 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GSH2 Antibody from Novus Biologicals is a mouse polyclonal antibody to GSH2. This antibody reacts with human. The GSH2 Antibody has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GSH2 (NP_573574, 1 a.a. 70 a.a) partial recombinant protein with GST tag.MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPP PLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH |
|---|
| Other Names | GS homeobox 2, GSH2, Homeobox protein GSH-2 |
|---|
| Gene, Accession # | GSX2, Gene ID: 170825, Accession: NP_573574, SwissProt: NP_573574 |
|---|
| Catalog # | H00170825-A01 |
|---|
| Price | |
|---|
| Order / More Info | GSH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|