| Edit |   |
| Antigenic Specificity | TMEM161B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM161B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM161B. This antibody reacts with human. The TMEM161B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human TMEM161B. Peptide sequence GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH. |
| Other Names | MGC33214, transmembrane protein 161B, UNQ679/PRO1313 |
| Gene, Accession # | TMEM161B, Gene ID: 153396, Accession: NP_699185, SwissProt: NP_699185 |
| Catalog # | NBP1-91442 |
| Price | |
| Order / More Info | TMEM161B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |