| Edit |   |
| Antigenic Specificity | TMEM194B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM194B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM194B. This antibody reacts with human. The TMEM194B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TMEM194B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSALEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEI |
| Other Names | Nuclear Envelope Integral Membrane Protein 2, Transmembrane Protein 194B, UPF0571 Transmembrane Protein |
| Gene, Accession # | NEMP2, Gene ID: 100131211 |
| Catalog # | NBP2-55525 |
| Price | |
| Order / More Info | TMEM194B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |