| Edit |   |
|---|
| Antigenic Specificity | TMEM30B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM30B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM30B. This antibody reacts with human. The TMEM30B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM30B(transmembrane protein 30B) The peptide sequence was selected from the middle region of TMEM30B. Peptide sequence VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL. |
|---|
| Other Names | cell cycle control protein 50B, transmembrane protein 30BCDC50BMGC126775 |
|---|
| Gene, Accession # | TMEM30B, Gene ID: 161291, Accession: Q3MIR4, SwissProt: Q3MIR4 |
|---|
| Catalog # | NBP1-59534-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM30B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|