| Edit |   |
|---|
| Antigenic Specificity | TMEM63B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM63B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM63B. This antibody reacts with human. The TMEM63B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human TMEM63B. Peptide sequence VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA. |
|---|
| Other Names | transmembrane protein 63B |
|---|
| Gene, Accession # | TMEM63B, Gene ID: 55362, Accession: NP_060896, SwissProt: NP_060896 |
|---|
| Catalog # | NBP1-91555 |
|---|
| Price | |
|---|
| Order / More Info | TMEM63B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|