| Edit |   |
| Antigenic Specificity | TMEM106C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM106C Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM106C. This antibody reacts with human. The TMEM106C Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM106C(transmembrane protein 106C) The peptide sequence was selected from the middle region of TMEM106C. Peptide sequence NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG. |
| Other Names | EMOC, Endoplasmic reticulum membrane protein overexpressed in cancer, MGC111210, MGC5576, transmembrane protein 106C |
| Gene, Accession # | TMEM106C, Gene ID: 79022, Accession: Q9BVX2, SwissProt: Q9BVX2 |
| Catalog # | NBP1-59829-20ul |
| Price | |
| Order / More Info | TMEM106C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |