| Edit |   |
|---|
| Antigenic Specificity | TMEM106C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM106C Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM106C. This antibody reacts with human. The TMEM106C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM106C(transmembrane protein 106C) The peptide sequence was selected from the middle region of TMEM106C. Peptide sequence NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG. |
|---|
| Other Names | EMOC, Endoplasmic reticulum membrane protein overexpressed in cancer, MGC111210, MGC5576, transmembrane protein 106C |
|---|
| Gene, Accession # | TMEM106C, Gene ID: 79022, Accession: Q9BVX2, SwissProt: Q9BVX2 |
|---|
| Catalog # | NBP1-59829 |
|---|
| Price | |
|---|
| Order / More Info | TMEM106C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|