| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD1d |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD1d Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD1d. This antibody reacts with human. The CD1d Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CD1d antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW |
|---|
| Other Names | antigen-presenting glycoprotein CD1d, CD1A, CD1d antigen, CD1D antigen, d polypeptide, CD1d molecule, differentiation antigen CD1-alpha-3, HMC class I antigen-like glycoprotein CD1D, MGC34622, R3, R3G1, T-cell surface glycoprotein CD1d, thymocyte antigen CD1D |
|---|
| Gene, Accession # | CD1D, Gene ID: 912 |
|---|
| Catalog # | NBP2-57561 |
|---|
| Price | |
|---|
| Order / More Info | CD1d Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|