| Edit |   |
|---|
| Antigenic Specificity | RPS21 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPS21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS21. This antibody reacts with human. The RPS21 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPS21 (ribosomal protein S21) The peptide sequence was selected from the middle region of RPS21. Peptide sequence NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF. |
|---|
| Other Names | ribosomal protein S21,40S ribosomal protein S21,8.2 kDa differentiation factor |
|---|
| Gene, Accession # | RPS21, Gene ID: 6227, Accession: P63220, SwissProt: P63220 |
|---|
| Catalog # | NBP1-54931 |
|---|
| Price | |
|---|
| Order / More Info | RPS21 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|