| Edit |   |
|---|
| Antigenic Specificity | RPS24 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPS24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS24. This antibody reacts with human. The RPS24 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPS24(ribosomal protein S24) The peptide sequence was selected from the middle region of RPS24. Peptide sequence GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT. |
|---|
| Other Names | DBA3,40S ribosomal protein S24, DKFZp686N1586, ribosomal protein S24 |
|---|
| Gene, Accession # | RPS24, Gene ID: 6229, Accession: P62847, SwissProt: P62847 |
|---|
| Catalog # | NBP1-57404-20ul |
|---|
| Price | |
|---|
| Order / More Info | RPS24 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26149657 |
|---|