| 产品详情 |
| Edit |   |
| Antigenic Specificity | DMBT1/GP340 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DMBT1/GP340 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DMBT1/GP340. This antibody reacts with human. The DMBT1/GP340 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DMBT1/GP340 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR |
| Other Names | deleted in malignant brain tumors 1, deleted in malignant brain tumors 1 protein, FLJ61058, Glycoprotein 340, gp-340, GP340muclin, Hensin, MGC164738, SAG, Salivary agglutinin, Surfactant pulmonary-associated D-binding protein |
| Gene, Accession # | DMBT1, Gene ID: 1755, Accession: Q9UGM3, SwissProt: Q9UGM3 |
| Catalog # | NBP2-38471 |
| Price | |
| Order / More Info | DMBT1/GP340 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|