| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sphingosine 1 phosphate phosphatase 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sphingosine 1 phosphate phosphatase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sphingosine 1 phosphate phosphatase 2. This antibody reacts with human. The Sphingosine 1 phosphate phosphatase 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL. |
|---|
| Other Names | EC 3.1.3, EC 3.1.3.-, FLJ39004, hSPP2, sphingosine 1-phosphate phosphohydrolase 2, Sphingosine-1-phosphatase 2, sphingosine-1-phosphate phosphatase 2, Spp2, SPP2sphingosine-1-phosphate phosphotase 2, SPPase2 |
|---|
| Gene, Accession # | SGPP2, Gene ID: 130367 |
|---|
| Catalog # | NBP1-53181 |
|---|
| Price | |
|---|
| Order / More Info | Sphingosine 1 phosphate phosphatase 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|