| Edit |   |
|---|
| Antigenic Specificity | SPHKAP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPHKAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPHKAP. This antibody reacts with human. The SPHKAP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SPHKAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHP |
|---|
| Other Names | A-kinase anchor protein SPHKAP, SKIP, sphingosine kinase type 1-interacting protein, SPHK1 (sphingosine kinase type 1) interacting protein, SPHK1 interactor, AKAP domain containing, SPHK1-interactor and AKAP domain-containing protein |
|---|
| Gene, Accession # | SPHKAP, Gene ID: 80309, Accession: Q2M3C7, SwissProt: Q2M3C7 |
|---|
| Catalog # | NBP2-30973 |
|---|
| Price | |
|---|
| Order / More Info | SPHKAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|