| Edit |   |
|---|
| Antigenic Specificity | SPICE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPICE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPICE1. This antibody reacts with human. The SPICE1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC52(coiled-coil domain containing 52) The peptide sequence was selected from the middle region of CCDC52 (NP_653319). Peptide sequence KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL. |
|---|
| Other Names | CCDC52, FLJ26064, SPICE, spindle and centriole associated protein 1 |
|---|
| Gene, Accession # | SPICE1, Gene ID: 152185, Accession: Q8N0Z3, SwissProt: Q8N0Z3 |
|---|
| Catalog # | NBP1-70712-20ul |
|---|
| Price | |
|---|
| Order / More Info | SPICE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|