| Edit |   |
| Antigenic Specificity | SPICE1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPICE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPICE1. This antibody reacts with human. The SPICE1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC52(coiled-coil domain containing 52) The peptide sequence was selected from the middle region of CCDC52 (NP_653319). Peptide sequence KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL. |
| Other Names | CCDC52, FLJ26064, SPICE, spindle and centriole associated protein 1 |
| Gene, Accession # | SPICE1, Gene ID: 152185, Accession: Q8N0Z3, SwissProt: Q8N0Z3 |
| Catalog # | NBP1-70712 |
| Price | |
| Order / More Info | SPICE1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |