| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PSMB10/MECL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | 0.5 mg/ml |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PSMB10/MECL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMB10/MECL1. This antibody reacts with human. The PSMB10/MECL1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: beta type-10 |
|---|
| Immunogen | Synthetic peptides corresponding to PSMB10(proteasome (prosome, macropain) subunit, beta type, 10) The peptide sequence was selected from the middle region of PSMB10. Peptide sequence DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG. |
|---|
| Other Names | beta2i, FLJ00366, LMP10Proteasome subunit beta-2i, Low molecular mass protein 10, Macropain subunit MECl-1, MECL1EC 3.4.25.1, MGC1665, Multicatalytic endopeptidase complex subunit MECl-1, proteasome (prosome, macropain) subunit, beta type, 10, proteasome catalytic subunit 2i, Proteasome MECl-1, proteasome subunit beta 7i, proteasome subunit beta type-10, proteasome subunit MECL1 |
|---|
| Gene, Accession # | PSMB10, Gene ID: 5699, Accession: P40306, SwissProt: P40306 |
|---|
| Catalog # | NBP1-58937 |
|---|
| Price | |
|---|
| Order / More Info | PSMB10/MECL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|