| Edit |   |
| Antigenic Specificity | ARL2BP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL2BP Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL2BP. This antibody reacts with human. The ARL2BP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARL2BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNN |
| Other Names | ADP-ribosylation factor-like 2 binding protein, ADP-ribosylation factor-like protein 2-binding protein, ARF-like 2-binding protein, BART1binder of Arl Two, BARTArf-like 2 binding protein BART1, Binder of ARF2 protein 1, binder of Arl2 |
| Gene, Accession # | ARL2BP, Gene ID: 23568, Accession: Q9Y2Y0, SwissProt: Q9Y2Y0 |
| Catalog # | NBP2-30681 |
| Price | |
| Order / More Info | ARL2BP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |