| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Leukotriene B4 R1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Leukotriene B4 R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Leukotriene B4 R1. This antibody reacts with human. The Leukotriene B4 R1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Leukotriene B4R1/BLT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE |
|---|
| Other Names | chemokine receptor-like 1, CMKRL1, leukotriene B4 receptor, LTBR1, P2Y purinoceptor 7, purinergic receptor P2Y, G-protein coupled, 7 |
|---|
| Gene, Accession # | LTB4R, Gene ID: 1241 |
|---|
| Catalog # | NBP1-89959 |
|---|
| Price | |
|---|
| Order / More Info | Leukotriene B4 R1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23631827 |
|---|
| 产品资料 |
|
|