| 产品详情 |
| Edit |   |
| Antigenic Specificity | NASP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NASP Antibody from Novus Biologicals is a rabbit polyclonal antibody to NASP. This antibody reacts with human. The NASP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human NASP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSG |
| Other Names | DKFZp547F162, FLB7527, FLJ31599, FLJ35510, histone H1-binding protein, MGC19722, MGC20372, MGC2297, nuclear autoantigenic sperm protein, nuclear autoantigenic sperm protein (histone-binding), PRO1999 |
| Gene, Accession # | NASP, Gene ID: 4678, Accession: P49321, SwissProt: P49321 |
| Catalog # | NBP2-33928 |
| Price | |
| Order / More Info | NASP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|