| Edit |   |
| Antigenic Specificity | LST3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LST3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LST3. This antibody reacts with human. The LST3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LST-3TM12(organic anion transporter LST-3b) The peptide sequence was selected from the middle region of LST-3TM12. Peptide sequence LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH. |
| Other Names | liver-specific organic anion transporter 3, liver-specific organic anion transporter 3TM12, LST3, organic anion transporter LST-3b |
| Gene, Accession # | SLCO1B7, Gene ID: 338821, Accession: Q71QF0, SwissProt: Q71QF0 |
| Catalog # | NBP1-59440 |
| Price | |
| Order / More Info | LST3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |