| Edit |   |
|---|
| Antigenic Specificity | Epiregulin |
|---|
| Clone | 1E6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Epiregulin Antibody (1E6) from Novus Biologicals is a mouse monoclonal antibody to Epiregulin. This antibody reacts with human. The Epiregulin Antibody (1E6) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | EREG (NP_001423, 32 a.a. - 117 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE |
|---|
| Other Names | epiregulin, ER, proepiregulin |
|---|
| Gene, Accession # | EREG, Gene ID: 2069, Accession: NP_001423, SwissProt: NP_001423 |
|---|
| Catalog # | H00002069-M01 |
|---|
| Price | |
|---|
| Order / More Info | Epiregulin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|