| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBE2N/Ubc13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBE2N/Ubc13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBE2N/Ubc13. This antibody reacts with human. The UBE2N/Ubc13 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat UBE2N/Ubc13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA |
|---|
| Other Names | bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog |
|---|
| Gene, Accession # | UBE2N, Gene ID: 7334 |
|---|
| Catalog # | NBP2-48823 |
|---|
| Price | |
|---|
| Order / More Info | UBE2N/Ubc13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|