| Edit |   |
| Antigenic Specificity | RNF182 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF182 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF182. This antibody reacts with human. The RNF182 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RNF182(ring finger protein 182) The peptide sequence was selected from the middle region of RNF182. Peptide sequence LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY. |
| Other Names | E3 ubiquitin-protein ligase RNF182, EC 6.3.2.-, FLJ40772, ring finger protein 182MGC33993 |
| Gene, Accession # | RNF182, Gene ID: 221687, Accession: Q8N6D2, SwissProt: Q8N6D2 |
| Catalog # | NBP1-59763-20ul |
| Price | |
| Order / More Info | RNF182 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |