| Edit |   |
|---|
| Antigenic Specificity | RNF186 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF186 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF186. This antibody reacts with human. The RNF186 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RNF186(ring finger protein 186) The peptide sequence was selected from the N terminal of RNF186. Peptide sequence MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP. |
|---|
| Other Names | FLJ20225, ring finger protein 186, RP11-91K11.1 |
|---|
| Gene, Accession # | RNF186, Gene ID: 54546, Accession: Q9NXI6, SwissProt: Q9NXI6 |
|---|
| Catalog # | NBP1-59773-20ul |
|---|
| Price | |
|---|
| Order / More Info | RNF186 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|