| Edit |   |
| Antigenic Specificity | RNF208 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF208 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF208. This antibody reacts with human. The RNF208 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RNF208 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCGAACTCHVRNPLS |
| Other Names | DKFZP761H1710, MGC88636, ring finger protein 208 |
| Gene, Accession # | RNF208, Gene ID: 727800 |
| Catalog # | NBP1-90501 |
| Price | |
| Order / More Info | RNF208 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |