| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIEZO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIEZO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIEZO2. This antibody reacts with human. The PIEZO2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PIEZO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLS |
|---|
| Other Names | C18orf30, C18orf58, FAM38B, FAM38B2, family with sequence similarity 38, member B, family with sequence similarity 38, member B2, FLJ23144, FLJ23403, FLJ25916, FLJ34907, FLJ37734, FLJ45725, HsT748, HsT771, piezo-type mechanosensitive ion channel component 2, protein PIEZO2 |
|---|
| Gene, Accession # | PIEZO2, Gene ID: 63895 |
|---|
| Catalog # | NBP2-58161 |
|---|
| Price | |
|---|
| Order / More Info | PIEZO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|