| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VPS37B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VPS37B Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS37B. This antibody reacts with human. The VPS37B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VPS37B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASL |
|---|
| Other Names | ESCRT-I complex subunit VPS37B, FLJ12750, hVps37B, vacuolar protein sorting 37 homolog B (S. cerevisiae), vacuolar protein sorting 37B, vacuolar protein sorting 37B (yeast), vacuolar protein sorting-associated protein 37B |
|---|
| Gene, Accession # | VPS37B, Gene ID: 79720, Accession: Q9H9H4, SwissProt: Q9H9H4 |
|---|
| Catalog # | NBP2-38398 |
|---|
| Price | |
|---|
| Order / More Info | VPS37B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|