| 产品详情 |
| Edit |   |
| Antigenic Specificity | Hyaluronan Synthase 3/HAS3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28287145). WB reactivity per customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Hyaluronan Synthase 3/HAS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hyaluronan Synthase 3/HAS3. This antibody reacts with human, rat. The Hyaluronan Synthase 3/HAS3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat Hyaluronan Synthase 3/HAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC |
| Other Names | EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3 |
| Gene, Accession # | HAS3, Gene ID: 3038 |
| Catalog # | NBP1-86328 |
| Price | |
| Order / More Info | Hyaluronan Synthase 3/HAS3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28287145 |
| 产品资料 |
|
|