| Edit |   |
| Antigenic Specificity | Hyaluronan Synthase 3/HAS3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Hyaluronan Synthase 3/HAS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hyaluronan Synthase 3/HAS3. This antibody reacts with human. The Hyaluronan Synthase 3/HAS3 Antibody has been validated for the following applications: Western Blot. Specificity: HAS3 isoform B (NP_619515) |
| Immunogen | Synthetic peptides corresponding to HAS3(hyaluronan synthase 3), The peptide sequence was selected from the C terminal of HAS3. Peptide sequence SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR. |
| Other Names | EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3 |
| Gene, Accession # | HAS3, Gene ID: 3038, Accession: Q8WTZ0, SwissProt: Q8WTZ0 |
| Catalog # | NBP1-62552 |
| Price | |
| Order / More Info | Hyaluronan Synthase 3/HAS3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |