| 产品详情 |
| Edit |   |
| Antigenic Specificity | RFC5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RFC5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFC5. This antibody reacts with human. The RFC5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RFC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI |
| Other Names | Activator 1 36 kDa subunit, Activator 1 subunit 5,36.5 kD subunit, MGC1155, replication factor C (activator 1) 5, 36.5kDa, RF-C 36 kDa subunit, RFC36replication factor C (activator 1) 5 (36.5kD) |
| Gene, Accession # | RFC5, Gene ID: 5985 |
| Catalog # | NBP1-87137 |
| Price | |
| Order / More Info | RFC5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|