| 产品详情 |
| Edit |   |
| Antigenic Specificity | FABP7/B-FABP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25389781). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FABP7/B-FABP Antibody from Novus Biologicals is a rabbit polyclonal antibody to FABP7/B-FABP. This antibody reacts with human. The FABP7/B-FABP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FABP7/B-FABP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK |
| Other Names | B-FABPDKFZp547J2313, BLBPMRG, Brain lipid-binding protein, Brain-type fatty acid-binding protein, FABPBbrain lipid binding protein, fatty acid binding protein 7, brain, Fatty acid-binding protein 7, fatty acid-binding protein, brain, Mammary-derived growth inhibitor related, mammary-derived growth inhibitor-related |
| Gene, Accession # | FABP7, Gene ID: 2173 |
| Catalog # | NBP1-88648 |
| Price | |
| Order / More Info | FABP7/B-FABP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24653654, 25389781 |
| 产品资料 |
|
|