| Edit |   |
|---|
| Antigenic Specificity | FABP5/E-FABP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FABP5/E-FABP Antibody from Novus Biologicals is a rabbit polyclonal antibody to FABP5/E-FABP. This antibody reacts with mouse. The FABP5/E-FABP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is fatty acid binding protein 5 - C-terminal region. Peptide sequence RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV. |
|---|
| Other Names | EFABP, E-FABPPAFABP, fatty acid binding protein 5 (psoriasis-associated), Fatty acid-binding protein 5, PA-FABPepidermal, Psoriasis-associated fatty acid-binding protein homolog |
|---|
| Gene, Accession # | FABP5, Gene ID: 2171, Accession: NP_034764 |
|---|
| Catalog # | NBP1-98462-20ul |
|---|
| Price | |
|---|
| Order / More Info | FABP5/E-FABP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|