| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NSFL1C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NSFL1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to NSFL1C. This antibody reacts with human. The NSFL1C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NSFL1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVER VTKSPGETSKPRPFAGGGYRLG |
|---|
| Other Names | dJ776F14.1, NSFL1 (p97) cofactor (p47), NSFL1 cofactor p47, p47, p97 cofactor p47, SHP1 homolog, UBX domain protein 2C, UBX domain-containing protein 2C, UBX1, UBXD10, UBXN2CMGC3347 |
|---|
| Gene, Accession # | NSFL1C, Gene ID: 55968 |
|---|
| Catalog # | NBP2-13677 |
|---|
| Price | |
|---|
| Order / More Info | NSFL1C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|