| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SHPRH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHPRH Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHPRH. This antibody reacts with human. The SHPRH Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SHPRH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSVKLNIVISPYHFDNSWKAFLGELTLQLLPAQSLIENFSERSITLMSSESSNQFLIYVHSKGEDVEKQKKEPMSICDKGILVESSFSGEMLEDLGWLQ |
|---|
| Other Names | 2610103K11Rik, bA545I5.2, E3 ubiquitin-protein ligase SHPRH, EC 3.6.4.-, EC 6.3.2.-, FLJ27258, FLJ37625, FLJ90837, histone-linker, PHD and RING finger domain-containing helicase, KIAA2023FLJ45012, MGC134886, SNF2 histone linker PHD RING helicase |
|---|
| Gene, Accession # | SHPRH, Gene ID: 257218 |
|---|
| Catalog # | NBP2-55114 |
|---|
| Price | |
|---|
| Order / More Info | SHPRH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|