| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HDHD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HDHD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HDHD2. This antibody reacts with human. The HDHD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HDHD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKG |
|---|
| Other Names | DKFZp564D1378, DKFZP564D1378,3110052N05Rik, haloacid dehalogenase-like hydrolase domain containing 2, haloacid dehalogenase-like hydrolase domain-containing protein 2 |
|---|
| Gene, Accession # | HDHD2, Gene ID: 84064, Accession: Q9H0R4, SwissProt: Q9H0R4 |
|---|
| Catalog # | NBP2-31799 |
|---|
| Price | |
|---|
| Order / More Info | HDHD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|