| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calpain small subunit 1 |
|---|
| Clone | 3C4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calpain small subunit 1 Antibody (3C4) from Novus Biologicals is a mouse monoclonal antibody to Calpain small subunit 1. This antibody reacts with human, rat. The Calpain small subunit 1 Antibody (3C4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | CAPNS1 (AAH00592 172 a.a. - 260 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE |
|---|
| Other Names | Calcium-activated neutral proteinase small subunit, Calcium-dependent protease small subunit, Calcium-dependent protease small subunit 1, calcium-dependent protease, small subunit, calpain 4, small subunit (30K), Calpain regulatory subunit, calpain small subunit 1, calpain, small polypeptide, calpain, small subunit 1, CANP, CANPS, CAPN4CALPAIN4,30K, CAPNS, CDPSCANP small subunit, CSS1 |
|---|
| Gene, Accession # | CAPNS1, Gene ID: 826, Accession: AAH00592, SwissProt: AAH00592 |
|---|
| Catalog # | H00000826-M01 |
|---|
| Price | |
|---|
| Order / More Info | Calpain small subunit 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19751822, 20846163, 22046434 |
|---|
| 产品资料 |
|
|