| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-7. This antibody reacts with human. The MMP-7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MMP-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHG |
|---|
| Other Names | EC 3.4.24, EC 3.4.24.23, matrilysin, matrin, matrix metallopeptidase 7 (matrilysin, uterine), matrix metalloproteinase 7 (matrilysin, uterine), Matrix metalloproteinase-7, MMP-7, MPSL1, PUMP1, PUMP-1, Pump-1 protease, uterine matrilysin, Uterine metalloproteinase |
|---|
| Gene, Accession # | MMP7, Gene ID: 4316 |
|---|
| Catalog # | NBP2-57142 |
|---|
| Price | |
|---|
| Order / More Info | MMP-7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|