| Edit |   |
|---|
| Antigenic Specificity | RNF148 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF148 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF148. This antibody reacts with human. The RNF148 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RNF148(ring finger protein 148) The peptide sequence was selected from the C terminal of RNF148 (NP_932351). Peptide sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP. |
|---|
| Other Names | MGC35222, ring finger protein 148 |
|---|
| Gene, Accession # | RNF148, Gene ID: 378925, Accession: Q8N7C7, SwissProt: Q8N7C7 |
|---|
| Catalog # | NBP1-59516 |
|---|
| Price | |
|---|
| Order / More Info | RNF148 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 8744354 |
|---|