| Edit |   |
|---|
| Antigenic Specificity | Sphingomyelin synthase 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sphingomyelin synthase 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sphingomyelin synthase 1. This antibody reacts with human. The Sphingomyelin synthase 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SGMS1(sphingomyelin synthase 1) The peptide sequence was selected from the middle region of SGMS1 (NP_671512). Peptide sequence SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI. |
|---|
| Other Names | MGC17342, MOBProtein Mob, phosphatidylcholine:ceramide cholinephosphotransferase 1, SMS1EC 2.7.8.27, sphingomyelin synthase 1Medulla oblongata-derived protein, TMEM23hmob33, Transmembrane protein 23MOB1 |
|---|
| Gene, Accession # | SGMS1, Gene ID: 259230, Accession: Q86VZ5, SwissProt: Q86VZ5 |
|---|
| Catalog # | NBP1-60081 |
|---|
| Price | |
|---|
| Order / More Info | Sphingomyelin synthase 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|