| Edit |   |
|---|
| Antigenic Specificity | Sphingomyelin Synthase 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sphingomyelin Synthase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sphingomyelin Synthase 2. This antibody reacts with human. The Sphingomyelin Synthase 2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SGMS2(sphingomyelin synthase 2) The peptide sequence was selected from the N terminal of SGMS2 (NP_689834). Peptide sequence KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY. |
|---|
| Other Names | EC 2.7.8.27, phosphatidylcholine:ceramide cholinephosphotransferase 2, SM synthase, sphingomyelin synthase 2SMS2MGC26963 |
|---|
| Gene, Accession # | SGMS2, Gene ID: 166929, Accession: Q8NHU3, SwissProt: Q8NHU3 |
|---|
| Catalog # | NBP1-60005 |
|---|
| Price | |
|---|
| Order / More Info | Sphingomyelin Synthase 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17982138 |
|---|