| Edit |   |
|---|
| Antigenic Specificity | CP2F2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CP2F2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CP2F2. This antibody reacts with rat. The CP2F2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is CP2F2 - middle region. Peptide sequence EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT. |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | Cyp2f2, Accession: NP_062176 |
|---|
| Catalog # | NBP1-98269 |
|---|
| Price | |
|---|
| Order / More Info | CP2F2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|