| Edit |   |
| Antigenic Specificity | CP2F2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CP2F2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CP2F2. This antibody reacts with rat. The CP2F2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is CP2F2 - middle region. Peptide sequence EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT. |
| Other Names | n/a |
| Gene, Accession # | Cyp2f2, Accession: NP_062176 |
| Catalog # | NBP1-98269 |
| Price | |
| Order / More Info | CP2F2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |