| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IFN-gamma R1/CD119 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFN-gamma R1/CD119 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFN-gamma R1/CD119. This antibody reacts with human. The IFN-gamma R1/CD119 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IFN-gamma R1/CD119/IFNGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL |
|---|
| Other Names | AVP, type 2, CD119, CD119 antigen, FLJ45734, IFN-gamma receptor 1, IFN-gamma-R1, IFNGR, immune interferon receptor 1, interferon gamma receptor 1, interferon-gamma receptor alpha chain, type 2 |
|---|
| Gene, Accession # | IFNGR1, Gene ID: 3459 |
|---|
| Catalog # | NBP2-49406 |
|---|
| Price | |
|---|
| Order / More Info | IFN-gamma R1/CD119 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|