| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HspA1L |
|---|
| Clone | 7H6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin, Proximity Ligation Assay. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HspA1L Antibody (7H6) from Novus Biologicals is a mouse monoclonal antibody to HspA1L. This antibody reacts with human, rat. The HspA1L Antibody (7H6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin, Proximity Ligation Assay. |
|---|
| Immunogen | HSPA1L (NP_005518 561 a.a. - 641 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
|---|
| Other Names | heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t |
|---|
| Gene, Accession # | HSPA1L, Gene ID: 3305, Accession: NP_005518, SwissProt: NP_005518 |
|---|
| Catalog # | H00003305-M02 |
|---|
| Price | |
|---|
| Order / More Info | HspA1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|