| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HspA4L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HspA4L Antibody from Novus Biologicals is a rabbit polyclonal antibody to HspA4L. This antibody reacts with human. The HspA4L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HspA4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY |
|---|
| Other Names | APG1, APG-1, heat shock 70 kDa protein 4L, heat shock 70 kDa protein 4-like protein, heat shock 70kDa protein 4-like, Heat shock 70-related protein APG-1, heat shock protein (hsp110 family), Osmotic stress protein 94, Osp94 |
|---|
| Gene, Accession # | HSPA4L, Gene ID: 22824 |
|---|
| Catalog # | NBP2-48700 |
|---|
| Price | |
|---|
| Order / More Info | HspA4L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|