| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-9. This antibody reacts with human. The MMP-9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MMP-9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE |
|---|
| Other Names | 92 kDa gelatinase, 92 kDa type IV collagenase, CLG4B, EC 3.4.24, EC 3.4.24.35, Gelatinase B, GELB, macrophage gelatinase, MANDP2, matrix metallopeptidase 9, matrix metalloproteinase 9, matrix metalloproteinase-9, MMP-9, type V collagenase |
|---|
| Gene, Accession # | MMP9, Gene ID: 4318, Accession: P14780, SwissProt: P14780 |
|---|
| Catalog # | NBP2-39011 |
|---|
| Price | |
|---|
| Order / More Info | MMP-9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|