| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Beta 2 Adaptin |
|---|
| Clone | 2D5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Beta 2 Adaptin Antibody (2D5) from Novus Biologicals is a mouse monoclonal antibody to Beta 2 Adaptin. This antibody reacts with human. The Beta 2 Adaptin Antibody (2D5) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | AP2B1 (NP_001273.1 585 a.a. - 651 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG |
|---|
| Other Names | Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, adaptor-related protein complex 2, beta 1 subunit, ADTB2adaptin, beta 2 (beta), AP105B, AP2-BETA, Beta-2-adaptin, Beta-adaptin, CLAPB1AP-2 complex subunit beta, Clathrin assembly protein complex 2 beta large chain, clathrin-associated/assembly/adaptor protein, large, beta 1, DKFZp781K0743, Plasma membrane adaptor HA2/AP2 adaptin beta subunit |
|---|
| Gene, Accession # | AP2B1, Gene ID: 163, Accession: NP_001273, SwissProt: NP_001273 |
|---|
| Catalog # | H00000163-M01 |
|---|
| Price | |
|---|
| Order / More Info | Beta 2 Adaptin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|