| Edit |   |
|---|
| Antigenic Specificity | Thyroid receptor-interacting protein 11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Thyroid receptor-interacting protein 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Thyroid receptor-interacting protein 11. This antibody reacts with human. The Thyroid receptor-interacting protein 11 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Thyroid receptor-interacting protein 11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV |
|---|
| Other Names | CEV14TR-interacting protein 11, Clonal evolution-related gene on chromosome 14 protein, GMAP-210ACG1A, Golgi-associated microtubule-binding protein 210, Golgi-microtubule-associated protein of 210 kDa, thyroid hormone receptor interactor 11, thyroid receptor-interacting protein 11, TRIP-11, Trip230 |
|---|
| Gene, Accession # | TRIP11, Gene ID: 9321 |
|---|
| Catalog # | NBP2-57415 |
|---|
| Price | |
|---|
| Order / More Info | Thyroid receptor-interacting protein 11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|